Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) duplication: contains two subdomains of this fold |
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries) |
Domain d2fhkb1: 2fhk B:1-148 [133489] automated match to d1ftra1 complexed with k, mfn |
PDB Entry: 2fhk (more details), 2 Å
SCOPe Domain Sequences for d2fhkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhkb1 d.58.33.1 (B:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]} meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv gyklsffgdgyqeedeldgrkvwkipvv
Timeline for d2fhkb1: