SCOPe 2.06: Domain d2fhkb1: 2fhk B:1-148

Lineage for d2fhkb1 (2fhk B:1-148)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family)
   duplication: contains two subdomains of this fold

5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)

6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)

7. Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)

8. Domain d2fhkb1: 2fhk B:1-148 [133489]
   automated match to d1ftra1
   complexed with k, mfn

Details for d2fhkb1

PDB Entry: 2fhk, 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes

PDB Compounds: (B:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d2fhkb1:

Sequence; same for both SEQRES and ATOM records:

>d2fhkb1 d.58.33.1 (B:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

Timeline for d2fhkb1:

• d2fhkb1 first appeared in SCOP 1.73
  
• d2fhkb1 appears in SCOPe 2.05
  
• d2fhkb1 appears in SCOPe 2.07
  
• d2fhkb1 appears in the current release, SCOPe 2.08