Lineage for d2fhkb1 (2fhk B:1-148)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725871Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 725872Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 725873Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 725891Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 725910Domain d2fhkb1: 2fhk B:1-148 [133489]
    automatically matched to d1ftra1
    complexed with k, mfn

Details for d2fhkb1

PDB Entry: 2fhk (more details), 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
PDB Compounds: (B:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOP Domain Sequences for d2fhkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhkb1 d.58.33.1 (B:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

SCOP Domain Coordinates for d2fhkb1:

Click to download the PDB-style file with coordinates for d2fhkb1.
(The format of our PDB-style files is described here.)

Timeline for d2fhkb1: