Lineage for d2fhjd2 (2fhj D:149-296)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562193Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562194Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 2562195Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 2562213Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 2562237Domain d2fhjd2: 2fhj D:149-296 [133486]
    automated match to d1ftra2
    complexed with h4z, k, mfn, pe3, pe4

Details for d2fhjd2

PDB Entry: 2fhj (more details), 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
PDB Compounds: (D:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d2fhjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhjd2 d.58.33.1 (D:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa
skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac
qqpgvvkisagnfggklgqyeihlhdlf

SCOPe Domain Coordinates for d2fhjd2:

Click to download the PDB-style file with coordinates for d2fhjd2.
(The format of our PDB-style files is described here.)

Timeline for d2fhjd2: