Lineage for d2fhjb1 (2fhj B:1-148)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863823Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 863824Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 863825Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 863843Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 863862Domain d2fhjb1: 2fhj B:1-148 [133481]
    automatically matched to d1ftra1
    complexed with h4z, k, mfn, pe3, pe4

Details for d2fhjb1

PDB Entry: 2fhj (more details), 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
PDB Compounds: (B:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOP Domain Sequences for d2fhjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhjb1 d.58.33.1 (B:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

SCOP Domain Coordinates for d2fhjb1:

Click to download the PDB-style file with coordinates for d2fhjb1.
(The format of our PDB-style files is described here.)

Timeline for d2fhjb1: