SCOP 1.73: Domain d2fhja2: 2fhj A:149-296

Lineage for d2fhja2 (2fhj A:149-296)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family)
   duplication: contains two subdomains of this fold

5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)

6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)

7. Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)

8. Domain d2fhja2: 2fhj A:149-296 [133480]
   automatically matched to d1ftra2
   complexed with h4z, k, mfn, pe3, pe4

Details for d2fhja2

PDB Entry: 2fhj, 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes

PDB Compounds: (A:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOP Domain Sequences for d2fhja2:

Sequence; same for both SEQRES and ATOM records:

>d2fhja2 d.58.33.1 (A:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa
skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac
qqpgvvkisagnfggklgqyeihlhdlf

Timeline for d2fhja2:

• d2fhja2 is new in SCOP 1.73
  
• d2fhja2 appears in SCOP 1.75
  
• d2fhja2 appears in the current release, SCOPe 2.08