SCOP 1.73: Domain d2fh5b1: 2fh5 B:63-269

Lineage for d2fh5b1 (2fh5 B:63-269)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Signal recognition particle receptor beta-subunit [89664] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142224] (2 PDB entries)

8. Domain d2fh5b1: 2fh5 B:63-269 [133478]
   Other proteins in same PDB: d2fh5a1
   complexed with gtp, mg

Details for d2fh5b1

PDB Entry: 2fh5, 2.45 Å

PDB Description: The Structure of the Mammalian SRP Receptor

PDB Compounds: (B:) Signal recognition particle receptor beta subunit

SCOP Domain Sequences for d2fh5b1:

Sequence, based on SEQRES records:

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsqlplkvefl
ecsakggrgdtgsadiqdlekwlakia

Sequence, based on observed residues (ATOM records):

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl
ekwlakia

Timeline for d2fh5b1:

• d2fh5b1 is new in SCOP 1.73
  
• d2fh5b1 appears in SCOP 1.75
  
• d2fh5b1 appears in the current release, SCOPe 2.08