Lineage for d2fh5b1 (2fh5 B:63-269)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867883Protein Signal recognition particle receptor beta-subunit [89664] (2 species)
  7. 2867886Species Mouse (Mus musculus) [TaxId:10090] [142224] (2 PDB entries)
    Uniprot P47758 63-269
  8. 2867887Domain d2fh5b1: 2fh5 B:63-269 [133478]
    Other proteins in same PDB: d2fh5a1
    complexed with gtp, mg

Details for d2fh5b1

PDB Entry: 2fh5 (more details), 2.45 Å

PDB Description: The Structure of the Mammalian SRP Receptor
PDB Compounds: (B:) Signal recognition particle receptor beta subunit

SCOPe Domain Sequences for d2fh5b1:

Sequence, based on SEQRES records: (download)

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsqlplkvefl
ecsakggrgdtgsadiqdlekwlakia

Sequence, based on observed residues (ATOM records): (download)

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl
ekwlakia

SCOPe Domain Coordinates for d2fh5b1:

Click to download the PDB-style file with coordinates for d2fh5b1.
(The format of our PDB-style files is described here.)

Timeline for d2fh5b1: