Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Signal recognition particle receptor beta-subunit [89664] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142224] (2 PDB entries) Uniprot P47758 63-269 |
Domain d2fh5b1: 2fh5 B:63-269 [133478] Other proteins in same PDB: d2fh5a1 complexed with gtp, mg |
PDB Entry: 2fh5 (more details), 2.45 Å
SCOPe Domain Sequences for d2fh5b1:
Sequence, based on SEQRES records: (download)
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi amaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsqlplkvefl ecsakggrgdtgsadiqdlekwlakia
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl ekwlakia
Timeline for d2fh5b1: