![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
![]() | Protein automated matches [190971] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries) |
![]() | Domain d2fh4b3: 2fh4 B:629-741 [133473] automated match to d1npha3 |
PDB Entry: 2fh4 (more details), 3 Å
SCOPe Domain Sequences for d2fh4b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh4b3 d.109.1.0 (B:629-741) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw
Timeline for d2fh4b3: