Lineage for d2fh4b1 (2fh4 B:414-532)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. Protein automated matches [190971] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries)
  8. Domain d2fh4b1: 2fh4 B:414-532 [133471]
    automated match to d1npha1

Details for d2fh4b1

PDB Entry: 2fh4 (more details), 3 Å

PDB Description: c-terminal half of gelsolin soaked in egta at ph 8
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d2fh4b1:

Sequence, based on SEQRES records: (download)

>d2fh4b1 d.109.1.0 (B:414-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqstq
devaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqta

Sequence, based on observed residues (ATOM records): (download)

>d2fh4b1 d.109.1.0 (B:414-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrqgqiiynwqgaqstqdeva
asailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtqta

SCOPe Domain Coordinates for d2fh4b1 are not available.

Timeline for d2fh4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fh4b2, d2fh4b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2fh4a1, d2fh4a2, d2fh4a3, d2fh4c1, d2fh4c2, d2fh4c3