Lineage for d2fh3c2 (2fh3 C:533-628)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870460Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870461Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 870462Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 870463Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 870480Species Human (Homo sapiens) [TaxId:9606] [55761] (28 PDB entries)
    Uniprot P20065 55-179
  8. 870533Domain d2fh3c2: 2fh3 C:533-628 [133466]
    automatically matched to d1h1vg2
    complexed with ca

Details for d2fh3c2

PDB Entry: 2fh3 (more details), 2.87 Å

PDB Description: c-terminal half of gelsolin soaked in low calcium at ph 8
PDB Compounds: (C:) gelsolin

SCOP Domain Sequences for d2fh3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh3c2 d.109.1.1 (C:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOP Domain Coordinates for d2fh3c2:

Click to download the PDB-style file with coordinates for d2fh3c2.
(The format of our PDB-style files is described here.)

Timeline for d2fh3c2: