Lineage for d2fh1b2 (2fh1 B:533-628)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427558Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1427559Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1427560Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1427577Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries)
    Uniprot P20065 55-179
  8. 1427583Domain d2fh1b2: 2fh1 B:533-628 [133445]
    automated match to d1p8xa2
    complexed with ca

Details for d2fh1b2

PDB Entry: 2fh1 (more details), 1.55 Å

PDB Description: c-terminal half of gelsolin soaked in low calcium at ph 4.5
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d2fh1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh1b2 d.109.1.1 (B:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOPe Domain Coordinates for d2fh1b2:

Click to download the PDB-style file with coordinates for d2fh1b2.
(The format of our PDB-style files is described here.)

Timeline for d2fh1b2: