Lineage for d2fh1a1 (2fh1 A:412-532)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969684Domain d2fh1a1: 2fh1 A:412-532 [133441]
    automated match to d1p8xa1
    complexed with ca

Details for d2fh1a1

PDB Entry: 2fh1 (more details), 1.55 Å

PDB Description: c-terminal half of gelsolin soaked in low calcium at ph 4.5
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d2fh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
a

SCOPe Domain Coordinates for d2fh1a1:

Click to download the PDB-style file with coordinates for d2fh1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fh1a1: