Lineage for d2fgra1 (2fgr A:1-332)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886253Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 886254Protein Porin [56937] (5 species)
  7. 886255Species Comamonas acidovorans [TaxId:80866] [64534] (3 PDB entries)
    Anion-selective porin OMP32
  8. 886257Domain d2fgra1: 2fgr A:1-332 [133440]
    automatically matched to d1e54a_
    complexed with ca, so4; mutant

Details for d2fgra1

PDB Entry: 2fgr (more details), 1.5 Å

PDB Description: High resolution Xray structure of Omp32
PDB Compounds: (A:) outer membrane porin protein 32

SCOP Domain Sequences for d2fgra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgra1 f.4.3.1 (A:1-332) Porin {Comamonas acidovorans [TaxId: 80866]}
essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
stlglqakgvyaggvqagesqtgvqvgirhaf

SCOP Domain Coordinates for d2fgra1:

Click to download the PDB-style file with coordinates for d2fgra1.
(The format of our PDB-style files is described here.)

Timeline for d2fgra1: