Lineage for d2fgqx_ (2fgq X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251502Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2251573Protein automated matches [190289] (5 species)
    not a true protein
  7. 2251574Species Delftia acidovorans [TaxId:80866] [187093] (2 PDB entries)
  8. 2251575Domain d2fgqx_: 2fgq X: [133439]
    automated match to d1e54a_
    complexed with bog, ca, mlt, so4

Details for d2fgqx_

PDB Entry: 2fgq (more details), 1.45 Å

PDB Description: high resolution x-ray structure of omp32 in complex with malate
PDB Compounds: (X:) outer membrane porin protein 32

SCOPe Domain Sequences for d2fgqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgqx_ f.4.3.1 (X:) automated matches {Delftia acidovorans [TaxId: 80866]}
svtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlegeif
gddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrnwa
agqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydngp
lsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktnsym
lgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkdast
lglqakgvyaggvqagesqtgvqvgirhaf

SCOPe Domain Coordinates for d2fgqx_:

Click to download the PDB-style file with coordinates for d2fgqx_.
(The format of our PDB-style files is described here.)

Timeline for d2fgqx_: