Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (1 protein) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Comamonas acidovorans [TaxId:80866] [64534] (3 PDB entries) Anion-selective porin OMP32 |
Domain d2fgqx1: 2fgq X:3-332 [133439] automatically matched to d1e54a_ complexed with bog, ca, mlt, so4 |
PDB Entry: 2fgq (more details), 1.45 Å
SCOP Domain Sequences for d2fgqx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]} svtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlegeif gddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrnwa agqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydngp lsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktnsym lgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkdast lglqakgvyaggvqagesqtgvqvgirhaf
Timeline for d2fgqx1: