SCOP 1.73: Domain d2fgqx1: 2fgq X:3-332

Lineage for d2fgqx1 (2fgq X:3-332)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Comamonas acidovorans [TaxId:80866] [64534] (3 PDB entries)
   Anion-selective porin OMP32

8. Domain d2fgqx1: 2fgq X:3-332 [133439]
   automatically matched to d1e54a_
   complexed with bog, ca, mlt, so4

Details for d2fgqx1

PDB Entry: 2fgq, 1.45 Å

PDB Description: high resolution x-ray structure of omp32 in complex with malate

PDB Compounds: (X:) outer membrane porin protein 32

SCOP Domain Sequences for d2fgqx1:

Sequence; same for both SEQRES and ATOM records:

>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]}
svtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlegeif
gddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrnwa
agqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydngp
lsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktnsym
lgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkdast
lglqakgvyaggvqagesqtgvqvgirhaf

Timeline for d2fgqx1:

• d2fgqx1 is new in SCOP 1.73
  
• d2fgqx1 appears in SCOP 1.75
  
• d2fgqx1 appears in the current release, SCOPe 2.08, called d2fgqx_