Lineage for d2fgqx1 (2fgq X:3-332)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744694Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 744736Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 744737Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 744738Protein Porin [56937] (5 species)
  7. 744739Species Comamonas acidovorans [TaxId:80866] [64534] (3 PDB entries)
    Anion-selective porin OMP32
  8. 744740Domain d2fgqx1: 2fgq X:3-332 [133439]
    automatically matched to d1e54a_
    complexed with bog, ca, mlt, so4

Details for d2fgqx1

PDB Entry: 2fgq (more details), 1.45 Å

PDB Description: high resolution x-ray structure of omp32 in complex with malate
PDB Compounds: (X:) outer membrane porin protein 32

SCOP Domain Sequences for d2fgqx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]}
svtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlegeif
gddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrnwa
agqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydngp
lsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktnsym
lgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkdast
lglqakgvyaggvqagesqtgvqvgirhaf

SCOP Domain Coordinates for d2fgqx1:

Click to download the PDB-style file with coordinates for d2fgqx1.
(The format of our PDB-style files is described here.)

Timeline for d2fgqx1: