SCOPe 2.08: Domain d2fgqx_: 2fgq X:

Lineage for d2fgqx_ (2fgq X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (7 species)
   not a true protein

7. Species Delftia acidovorans [TaxId:80866] [187093] (2 PDB entries)

8. Domain d2fgqx_: 2fgq X: [133439]
   automated match to d1e54a_
   complexed with bog, ca, mlt, so4

Details for d2fgqx_

PDB Entry: 2fgq, 1.45 Å

PDB Description: high resolution x-ray structure of omp32 in complex with malate

PDB Compounds: (X:) outer membrane porin protein 32

SCOPe Domain Sequences for d2fgqx_:

Sequence; same for both SEQRES and ATOM records:

>d2fgqx_ f.4.3.1 (X:) automated matches {Delftia acidovorans [TaxId: 80866]}
svtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlegeif
gddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrnwa
agqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydngp
lsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktnsym
lgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkdast
lglqakgvyaggvqagesqtgvqvgirhaf

Timeline for d2fgqx_:

• d2fgqx_ first appeared in SCOP 1.73, called d2fgqx1
  
• d2fgqx_ appears in SCOPe 2.07