| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Presequence protease 1, PREP1 [143498] (1 species) duplication: comprises four domains of this fold; similar to the MPP alpha-beta heterodimer |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143499] (1 PDB entry) Uniprot Q9LJL3 100-356! Uniprot Q9LJL3 357-624! Uniprot Q9LJL3 625-882! Uniprot Q9LJL3 883-1078 |
| Domain d2fgea1: 2fge A:540-797 [133430] complexed with cl, mg, zn |
PDB Entry: 2fge (more details), 2.1 Å
SCOPe Domain Sequences for d2fgea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgea1 d.185.1.1 (A:540-797) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lnlgdipkeptyvptevgdingvkvlrhdlftndiiytevvfdigslkhellplvplfcq
sllemgtkdltfvqlnqligrktggisvypltssvrgkdepcskiivrgksmagraddlf
nlmncllqevqftdqqrfkqfvsqsrarmenrlrgsghgiaaarmdamlniagwmseqmg
glsyleflhtlekkvdedwegisssleeirrsllarngcivnmtadgksltnveksvakf
ldllpenpsgglvtwdgr
Timeline for d2fgea1:
View in 3DDomains from other chains: (mouse over for more information) d2fgeb1, d2fgeb2, d2fgeb3, d2fgeb4 |