Lineage for d2fg9a1 (2fg9 A:1-157)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 669993Protein 5-nitroimidazole resistance protein BT3078 [141364] (1 species)
  7. 669994Species Bacteroides thetaiotaomicron [TaxId:818] [141365] (1 PDB entry)
  8. 669995Domain d2fg9a1: 2fg9 A:1-157 [133426]
    complexed with edo, fad, ni

Details for d2fg9a1

PDB Entry: 2fg9 (more details), 2.2 Å

PDB Description: crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
PDB Compounds: (A:) 5-nitroimidazole antibiotic resistance protein

SCOP Domain Sequences for d2fg9a1:

Sequence, based on SEQRES records: (download)

>d2fg9a1 b.45.1.1 (A:1-157) 5-nitroimidazole resistance protein BT3078 {Bacteroides thetaiotaomicron [TaxId: 818]}
mktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtlylhsgpeggkiem
lqrnnnvcitfslghklvyqhkqvacsysmrsesamcrgkvefiedmeekrhaldiimrh
ytkdqfsysdpavrnvkvwkvpvdqmtgkvfglrade

Sequence, based on observed residues (ATOM records): (download)

>d2fg9a1 b.45.1.1 (A:1-157) 5-nitroimidazole resistance protein BT3078 {Bacteroides thetaiotaomicron [TaxId: 818]}
mktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtlylhsgpeggkiem
lqrnnnvcitfslghklvyqhcsysmrsesamcrgkvefiedmeekrhaldiimrhytkd
qfsysdpavrnvkvwkvpvdqmtgkvfglrade

SCOP Domain Coordinates for d2fg9a1:

Click to download the PDB-style file with coordinates for d2fg9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fg9a1: