Lineage for d2fg9a1 (2fg9 A:1-157)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055234Family b.45.1.1: PNP-oxidase like [50476] (17 protein domains)
  6. 2055235Protein 5-nitroimidazole resistance protein BT3078 [141364] (1 species)
  7. 2055236Species Bacteroides thetaiotaomicron [TaxId:818] [141365] (1 PDB entry)
    Uniprot Q8A377 1-157
  8. 2055237Domain d2fg9a1: 2fg9 A:1-157 [133426]
    Other proteins in same PDB: d2fg9a2
    complexed with edo, fad, ni

Details for d2fg9a1

PDB Entry: 2fg9 (more details), 2.2 Å

PDB Description: crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
PDB Compounds: (A:) 5-nitroimidazole antibiotic resistance protein

SCOPe Domain Sequences for d2fg9a1:

Sequence, based on SEQRES records: (download)

>d2fg9a1 b.45.1.1 (A:1-157) 5-nitroimidazole resistance protein BT3078 {Bacteroides thetaiotaomicron [TaxId: 818]}
mktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtlylhsgpeggkiem
lqrnnnvcitfslghklvyqhkqvacsysmrsesamcrgkvefiedmeekrhaldiimrh
ytkdqfsysdpavrnvkvwkvpvdqmtgkvfglrade

Sequence, based on observed residues (ATOM records): (download)

>d2fg9a1 b.45.1.1 (A:1-157) 5-nitroimidazole resistance protein BT3078 {Bacteroides thetaiotaomicron [TaxId: 818]}
mktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtlylhsgpeggkiem
lqrnnnvcitfslghklvyqhcsysmrsesamcrgkvefiedmeekrhaldiimrhytkd
qfsysdpavrnvkvwkvpvdqmtgkvfglrade

SCOPe Domain Coordinates for d2fg9a1:

Click to download the PDB-style file with coordinates for d2fg9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fg9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fg9a2