![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Transcarbamylase-like protein [75308] (1 species) |
![]() | Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries) |
![]() | Domain d2fg7z2: 2fg7 Z:164-318 [133425] Other proteins in same PDB: d2fg7c3, d2fg7d3, d2fg7e3, d2fg7x3, d2fg7y3, d2fg7z3 automated match to d1js1x2 complexed with cp, sn0, so4 |
PDB Entry: 2fg7 (more details), 2.9 Å
SCOPe Domain Sequences for d2fg7z2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg7z2 c.78.1.1 (Z:164-318) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} tarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydq mkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmiv tddviespqsivipeaanreisatvvlkrllenlp
Timeline for d2fg7z2: