SCOPe 2.05: Domain d2fg7e1: 2fg7 E:-1-163

Lineage for d2fg7e1 (2fg7 E:-1-163)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Transcarbamylase-like protein [75308] (1 species)

7. Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries)

8. Domain d2fg7e1: 2fg7 E:-1-163 [133418]
   automated match to d1js1x1
   complexed with cp, sn0, so4

Details for d2fg7e1

PDB Entry: 2fg7, 2.9 Å

PDB Description: n-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline

PDB Compounds: (E:) putative ornithine carbamoyltransferase

SCOPe Domain Sequences for d2fg7e1:

Sequence; same for both SEQRES and ATOM records:

>d2fg7e1 c.78.1.1 (E:-1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
shmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaa
lnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenr
eydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

Timeline for d2fg7e1:

• d2fg7e1 first appeared in SCOP 1.73
  
• d2fg7e1 appears in SCOPe 2.04
  
• d2fg7e1 appears in SCOPe 2.06
  
• d2fg7e1 appears in the current release, SCOPe 2.08