SCOP 1.73: Domain d2fg6z1: 2fg6 Z:1-163

Lineage for d2fg6z1 (2fg6 Z:1-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Transcarbamylase-like protein [75308] (1 species)

7. Species Bacteroides fragilis [TaxId:817] [75309] (3 PDB entries)

8. Domain d2fg6z1: 2fg6 Z:1-163 [133412]
   automatically matched to d1js1x1
   complexed with sn0, so4; mutant

Details for d2fg6z1

PDB Entry: 2fg6, 2.8 Å

PDB Description: n-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline

PDB Compounds: (Z:) putative ornithine carbamoyltransferase

SCOP Domain Sequences for d2fg6z1:

Sequence; same for both SEQRES and ATOM records:

>d2fg6z1 c.78.1.1 (Z:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
mkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaaln
lgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenrey
dyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

Timeline for d2fg6z1:

• d2fg6z1 is new in SCOP 1.73
  
• d2fg6z1 appears in SCOP 1.75
  
• d2fg6z1 appears in the current release, SCOPe 2.08