SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2fg6d2 (2fg6 D:164-318)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139047Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2139440Protein Transcarbamylase-like protein [75308] (1 species)
  7. 2139441Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries)
  8. 2139463Domain d2fg6d2: 2fg6 D:164-318 [133405]
    Other proteins in same PDB: d2fg6c3, d2fg6d3, d2fg6e3, d2fg6x3, d2fg6y3, d2fg6z3
    automated match to d1js1x2
    complexed with sn0, so4

Details for d2fg6d2

PDB Entry: 2fg6 (more details), 2.8 Å

PDB Description: N-succinyl-L-ornithine transcarbamylase from B. fragilis complexed with sulfate and N-succinyl-L-norvaline
PDB Compounds: (D:) putative ornithine carbamoyltransferase

SCOPe Domain Sequences for d2fg6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg6d2 c.78.1.1 (D:164-318) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
tarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydq
mkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmiv
tddviespqsivipeaanreisatvvlkrllenlp

SCOPe Domain Coordinates for d2fg6d2:

Click to download the PDB-style file with coordinates for d2fg6d2.
(The format of our PDB-style files is described here.)

Timeline for d2fg6d2: