Lineage for d2fg6d1 (2fg6 D:1-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708619Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 708620Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 708621Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 protein domains)
  6. 708916Protein Transcarbamylase-like protein [75308] (1 species)
  7. 708917Species Bacteroides fragilis [TaxId:817] [75309] (3 PDB entries)
  8. 708926Domain d2fg6d1: 2fg6 D:1-163 [133404]
    automatically matched to d1js1x1
    complexed with sn0, so4; mutant

Details for d2fg6d1

PDB Entry: 2fg6 (more details), 2.8 Å

PDB Description: n-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
PDB Compounds: (D:) putative ornithine carbamoyltransferase

SCOP Domain Sequences for d2fg6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg6d1 c.78.1.1 (D:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
mkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaaln
lgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenrey
dyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

SCOP Domain Coordinates for d2fg6d1:

Click to download the PDB-style file with coordinates for d2fg6d1.
(The format of our PDB-style files is described here.)

Timeline for d2fg6d1: