Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab31 [142235] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142236] (1 PDB entry) Uniprot Q13636 3-167 |
Domain d2fg5a1: 2fg5 A:3-167 [133401] complexed with gnp, mg |
PDB Entry: 2fg5 (more details), 2.8 Å
SCOPe Domain Sequences for d2fg5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg5a1 c.37.1.8 (A:3-167) Rab31 {Human (Homo sapiens) [TaxId: 9606]} irelkvcllgdtgvgkssivcrfvqdhfdhnisptigasfmtktvpcgnelhkfliwdta gqerfhslapmyyrgsaaavivyditkqdsfytlkkwvkelkehgpenivmaiagnkcdl sdirevplkdakeyaesigaivvetsaknainieelfqgisrqip
Timeline for d2fg5a1: