SCOPe 2.01: Domain d2fg5a1: 2fg5 A:3-167

Lineage for d2fg5a1 (2fg5 A:3-167)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab31 [142235] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142236] (1 PDB entry)
   Uniprot Q13636 3-167

8. Domain d2fg5a1: 2fg5 A:3-167 [133401]
   complexed with gnp, mg

Details for d2fg5a1

PDB Entry: 2fg5, 2.8 Å

PDB Description: crystal structure of human rab31 in complex with a gtp analogue

PDB Compounds: (A:) Ras-related protein Rab-31

SCOPe Domain Sequences for d2fg5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fg5a1 c.37.1.8 (A:3-167) Rab31 {Human (Homo sapiens) [TaxId: 9606]}
irelkvcllgdtgvgkssivcrfvqdhfdhnisptigasfmtktvpcgnelhkfliwdta
gqerfhslapmyyrgsaaavivyditkqdsfytlkkwvkelkehgpenivmaiagnkcdl
sdirevplkdakeyaesigaivvetsaknainieelfqgisrqip

Timeline for d2fg5a1:

• d2fg5a1 first appeared in SCOP 1.73
  
• d2fg5a1 appears in SCOP 1.75
  
• d2fg5a1 appears in SCOPe 2.02
  
• d2fg5a1 appears in the current release, SCOPe 2.08