Lineage for d2fg5a1 (2fg5 A:3-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867438Protein Rab31 [142235] (1 species)
  7. 2867439Species Human (Homo sapiens) [TaxId:9606] [142236] (1 PDB entry)
    Uniprot Q13636 3-167
  8. 2867440Domain d2fg5a1: 2fg5 A:3-167 [133401]
    complexed with gnp, mg

Details for d2fg5a1

PDB Entry: 2fg5 (more details), 2.8 Å

PDB Description: crystal structure of human rab31 in complex with a gtp analogue
PDB Compounds: (A:) Ras-related protein Rab-31

SCOPe Domain Sequences for d2fg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg5a1 c.37.1.8 (A:3-167) Rab31 {Human (Homo sapiens) [TaxId: 9606]}
irelkvcllgdtgvgkssivcrfvqdhfdhnisptigasfmtktvpcgnelhkfliwdta
gqerfhslapmyyrgsaaavivyditkqdsfytlkkwvkelkehgpenivmaiagnkcdl
sdirevplkdakeyaesigaivvetsaknainieelfqgisrqip

SCOPe Domain Coordinates for d2fg5a1:

Click to download the PDB-style file with coordinates for d2fg5a1.
(The format of our PDB-style files is described here.)

Timeline for d2fg5a1: