SCOPe 2.08: Domain d2fg1a2: 2fg1 A:1-155

Lineage for d2fg1a2 (2fg1 A:1-155)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein automated matches [190472] (8 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [187703] (1 PDB entry)

8. Domain d2fg1a2: 2fg1 A:1-155 [133400]
   Other proteins in same PDB: d2fg1a3
   automated match to d2afca1

Details for d2fg1a2

PDB Entry: 2fg1, 1.25 Å

PDB Description: Structure of a Protein of Unknown Function from Bacteroides thetaiotaomicron.

PDB Compounds: (A:) conserved hypothetical protein BT1257

SCOPe Domain Sequences for d2fg1a2:

Sequence; same for both SEQRES and ATOM records:

>d2fg1a2 c.50.1.2 (A:1-155) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
meilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeef
tlgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhm
prigcglaggkwelmeqiikeelitkeiavtvydl

Timeline for d2fg1a2:

• d2fg1a2 first appeared in SCOP 1.73, called d2fg1a1
  
• d2fg1a2 appears in SCOPe 2.07