SCOP 1.75: Domain d2fg0b2: 2fg0 B:87-234

Lineage for d2fg0b2 (2fg0 B:87-234)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.16: NlpC/P60 [142873] (1 protein)
   Pfam PF00877

6. Protein Cell wall-associated hydrolase Spr C-terminal domain [142874] (1 species)

7. Species Nostoc punctiforme [TaxId:272131] [142875] (2 PDB entries)
   Uniprot Q8YRR4 87-234

8. Domain d2fg0b2: 2fg0 B:87-234 [133399]
   Other proteins in same PDB: d2fg0a1, d2fg0b1
   automatically matched to 2EVR A:87-234
   complexed with gol

Details for d2fg0b2

PDB Entry: 2fg0, 1.79 Å

PDB Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution

PDB Compounds: (B:) COG0791: Cell wall-associated hydrolases (invasion-associated proteins)

SCOP Domain Sequences for d2fg0b2:

Sequence; same for both SEQRES and ATOM records:

>d2fg0b2 d.3.1.16 (B:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]}
tfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqaafasvgiwlprday
qqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgkdqgrdgigidilse
qgdavslsyyqqlrgagrvfksyepqrr

Timeline for d2fg0b2:

• d2fg0b2 first appeared in SCOP 1.73
  
• d2fg0b2 appears in SCOPe 2.01
  
• d2fg0b2 appears in the current release, SCOPe 2.08