SCOPe 2.06: Domain d2fg0b1: 2fg0 B:13-86

Lineage for d2fg0b1 (2fg0 B:13-86)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families)

5. Family b.34.11.3: Spr N-terminal domain-like [141195] (1 protein)

6. Protein Cell wall-associated hydrolase Spr N-terminal domain [141196] (1 species)

7. Species Nostoc punctiforme [TaxId:272131] [141197] (2 PDB entries)
   Uniprot Q8YRR4 13-86

8. Domain d2fg0b1: 2fg0 B:13-86 [133398]
   Other proteins in same PDB: d2fg0a2, d2fg0b2
   automated match to d2evra1
   complexed with gol

Details for d2fg0b1

PDB Entry: 2fg0, 1.79 Å

PDB Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution

PDB Compounds: (B:) COG0791: Cell wall-associated hydrolases (invasion-associated proteins)

SCOPe Domain Sequences for d2fg0b1:

Sequence; same for both SEQRES and ATOM records:

>d2fg0b1 b.34.11.3 (B:13-86) Cell wall-associated hydrolase Spr N-terminal domain {Nostoc punctiforme [TaxId: 272131]}
klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd
fdslqpatvpyqaa

Timeline for d2fg0b1:

• d2fg0b1 first appeared in SCOP 1.73
  
• d2fg0b1 appears in SCOPe 2.05
  
• d2fg0b1 appears in SCOPe 2.07
  
• d2fg0b1 appears in the current release, SCOPe 2.08