Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families) |
Family b.34.11.3: Spr N-terminal domain-like [141195] (1 protein) |
Protein Cell wall-associated hydrolase Spr N-terminal domain [141196] (1 species) |
Species Nostoc punctiforme [TaxId:272131] [141197] (2 PDB entries) Uniprot Q8YRR4 13-86 |
Domain d2fg0a1: 2fg0 A:13-86 [133396] Other proteins in same PDB: d2fg0a2, d2fg0b2 automated match to d2evra1 complexed with gol |
PDB Entry: 2fg0 (more details), 1.79 Å
SCOPe Domain Sequences for d2fg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg0a1 b.34.11.3 (A:13-86) Cell wall-associated hydrolase Spr N-terminal domain {Nostoc punctiforme [TaxId: 272131]} klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd fdslqpatvpyqaa
Timeline for d2fg0a1: