Lineage for d2ffta1 (2fft A:2-84)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265289Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
  4. 2265290Superfamily g.88.1: TSP9-like [144256] (1 family) (S)
    automatically mapped to Pfam PF11493
  5. 2265291Family g.88.1.1: TSP9-like [144257] (1 protein)
  6. 2265292Protein Thylakoid soluble phosphoprotein TSP9 [144258] (1 species)
  7. 2265293Species Spinach (Spinacia oleracea) [TaxId:3562] [144259] (1 PDB entry)
    Uniprot Q8GT36 21-103
  8. 2265294Domain d2ffta1: 2fft A:2-84 [133393]
    Other proteins in same PDB: d2ffta2

Details for d2ffta1

PDB Entry: 2fft (more details)

PDB Description: nmr structure of spinach thylakoid soluble phosphoprotein of 9 kda in sds micelles
PDB Compounds: (A:) thylakoid soluble phosphoprotein

SCOPe Domain Sequences for d2ffta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffta1 g.88.1.1 (A:2-84) Thylakoid soluble phosphoprotein TSP9 {Spinach (Spinacia oleracea) [TaxId: 3562]}
aakgtaetkqeksfvdwllgkitkedqfyetdpilrggdvkssgstsgkkggttsgkkgt
vsipskkkngnggvfgglfakkd

SCOPe Domain Coordinates for d2ffta1:

Click to download the PDB-style file with coordinates for d2ffta1.
(The format of our PDB-style files is described here.)

Timeline for d2ffta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ffta2