Lineage for d2ffta1 (2fft A:2-84)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 752201Fold g.88: Intrinsically disordered proteins [144255] (1 superfamily)
    not a true fold
  4. 752202Superfamily g.88.1: TSP9-like [144256] (1 family) (S)
  5. 752203Family g.88.1.1: TSP9-like [144257] (1 protein)
  6. 752204Protein Thylakoid soluble phosphoprotein TSP9 [144258] (1 species)
  7. 752205Species Spinach (Spinacia oleracea) [TaxId:3562] [144259] (1 PDB entry)
  8. 752206Domain d2ffta1: 2fft A:2-84 [133393]

Details for d2ffta1

PDB Entry: 2fft (more details)

PDB Description: nmr structure of spinach thylakoid soluble phosphoprotein of 9 kda in sds micelles
PDB Compounds: (A:) thylakoid soluble phosphoprotein

SCOP Domain Sequences for d2ffta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffta1 g.88.1.1 (A:2-84) Thylakoid soluble phosphoprotein TSP9 {Spinach (Spinacia oleracea) [TaxId: 3562]}
aakgtaetkqeksfvdwllgkitkedqfyetdpilrggdvkssgstsgkkggttsgkkgt
vsipskkkngnggvfgglfakkd

SCOP Domain Coordinates for d2ffta1:

Click to download the PDB-style file with coordinates for d2ffta1.
(The format of our PDB-style files is described here.)

Timeline for d2ffta1: