SCOPe 2.08: Domain d2ffta1: 2fft A:2-84

Lineage for d2ffta1 (2fft A:2-84)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily g.88.1: TSP9-like [144256] (1 family)
   automatically mapped to Pfam PF11493

5. Family g.88.1.1: TSP9-like [144257] (1 protein)

6. Protein Thylakoid soluble phosphoprotein TSP9 [144258] (1 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [144259] (1 PDB entry)
   Uniprot Q8GT36 21-103

8. Domain d2ffta1: 2fft A:2-84 [133393]
   Other proteins in same PDB: d2ffta2

Details for d2ffta1

PDB Entry: 2fft

PDB Description: nmr structure of spinach thylakoid soluble phosphoprotein of 9 kda in sds micelles

PDB Compounds: (A:) thylakoid soluble phosphoprotein

SCOPe Domain Sequences for d2ffta1:

Sequence; same for both SEQRES and ATOM records:

>d2ffta1 g.88.1.1 (A:2-84) Thylakoid soluble phosphoprotein TSP9 {Spinach (Spinacia oleracea) [TaxId: 3562]}
aakgtaetkqeksfvdwllgkitkedqfyetdpilrggdvkssgstsgkkggttsgkkgt
vsipskkkngnggvfgglfakkd

Timeline for d2ffta1:

• d2ffta1 first appeared in SCOP 1.73
  
• d2ffta1 appears in SCOPe 2.07