SCOPe 2.08: Domain d2ffsb_: 2ffs B:

Lineage for d2ffsb_ (2ffs B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.7: PA1206-like [143839] (1 protein)
   automatically mapped to Pfam PF08982

6. Protein Hypothetical protein PA1206 [143840] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)
   Uniprot Q9I4D2 1-151

8. Domain d2ffsb_: 2ffs B: [133392]
   automated match to d2ffsa1

Details for d2ffsb_

PDB Entry: 2ffs, 2.5 Å

PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1

PDB Compounds: (B:) hypothetical protein PA1206

SCOPe Domain Sequences for d2ffsb_:

Sequence, based on SEQRES records:

>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrf

Sequence, based on observed residues (ATOM records):

>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlyl
pglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdel
pydafvkqayiamdvetiatirdrf

Timeline for d2ffsb_:

• d2ffsb_ first appeared in SCOP 1.73, called d2ffsb1
  
• d2ffsb_ appears in SCOPe 2.07