SCOP 1.73: Domain d2ffna1: 2ffn A:1-107

Lineage for d2ffna1 (2ffn A:1-107)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (11 PDB entries)

8. Domain d2ffna1: 2ffn A:1-107 [133390]
   automatically matched to d1it1a_
   complexed with hem; mutant

Details for d2ffna1

PDB Entry: 2ffn, 1.8 Å

PDB Description: The E41Q mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F

PDB Compounds: (A:) cytochrome c3

SCOP Domain Sequences for d2ffna1:

Sequence; same for both SEQRES and ATOM records:

>d2ffna1 a.138.1.1 (A:1-107) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

Timeline for d2ffna1:

• d2ffna1 is new in SCOP 1.73
  
• d2ffna1 appears in SCOP 1.75
  
• d2ffna1 appears in the current release, SCOPe 2.08, called d2ffna_