![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.50: AF1104-like [111320] (1 superfamily) 2 domains; d1: [all-alpha; 3-helical bundle, similar to the immunoglobulin/albumin-binding domain-like fold (46996)]; d2: [alpha/beta; 3 layers, a/b/a; 6-stranded mixed beta-sheet, order: 321456, strand 6 is antiparallel to the rest] |
![]() | Superfamily e.50.1: AF1104-like [111321] (1 family) ![]() automatically mapped to Pfam PF01937 |
![]() | Family e.50.1.1: AF1104-like [111322] (3 proteins) Pfam PF01937 |
![]() | Protein Hypothetical protein AF1104 [144047] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [144048] (1 PDB entry) Uniprot O29161 7-288 |
![]() | Domain d2ffjb_: 2ffj B: [133388] automated match to d2ffja1 complexed with cl, so4 |
PDB Entry: 2ffj (more details), 2.45 Å
SCOPe Domain Sequences for d2ffjb_:
Sequence, based on SEQRES records: (download)
>d2ffjb_ e.50.1.1 (B:) Hypothetical protein AF1104 {Archaeoglobus fulgidus [TaxId: 2234]} cpscllgrvyyeaklvtddedlisqcvdeslkilaenyssrpinahlatrihrrvyeilg vedpyaevkaranevarqvlplakeivegsddpfktavivsivgnnfdygvqghkvveee frdflkrkvqeglkindterikelssgkvvyltdnageiffdtllmkeikrrcekltavv rgrpiisdatiedarlarvdkiadelltngkgaigiimdelpdetrkaleeadlivakgm anyeclsdgslkpiaflltakcepvardigvnvgdmvakvve
>d2ffjb_ e.50.1.1 (B:) Hypothetical protein AF1104 {Archaeoglobus fulgidus [TaxId: 2234]} cpscllgrvyyeaklvtddedlisqcvdeslkilaeninahlatrihrrvyeilgvedpy aevkaranevarqvlplakeivegsddpfktavivsivgnnfhkvveeefrdflkrkvqe glkindterikelssgkvvyltdnageiffdtllmkeikrrcekltavvrgrpiisdati edarlarvdkiadelltngkgaigiimdelpdetrkaleeadlivakgmanyeclsdgsl kpiaflltakcepvardigvnvgdmvakvve
Timeline for d2ffjb_: