SCOPe 2.06: Domain d2ffia1: 2ffi A:10-280

Lineage for d2ffia1 (2ffi A:10-280)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 [141820] (1 species)

7. Species Pseudomonas putida [TaxId:303] [141821] (1 PDB entry)
   Uniprot Q88M75 10-280

8. Domain d2ffia1: 2ffi A:10-280 [133385]
   Other proteins in same PDB: d2ffia2, d2ffib3
   complexed with po4

Details for d2ffia1

PDB Entry: 2ffi, 2.61 Å

PDB Description: Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.

PDB Compounds: (A:) 2-pyrone-4,6-dicarboxylic acid hydrolase, putative

SCOPe Domain Sequences for d2ffia1:

Sequence; same for both SEQRES and ATOM records:

>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]}
lhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn
ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpl
lerigeqgwhvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltls
grgkvwvkvsgiyrlqgspeenlafarqalcaleahygaerlmwgsdwphtqhesevsfg
saveqfealgcsaqlrqallldtaralfgfe

Timeline for d2ffia1:

• d2ffia1 first appeared in SCOP 1.73
  
• d2ffia1 appears in SCOPe 2.05
  
• d2ffia1 appears in SCOPe 2.07
  
• d2ffia1 appears in the current release, SCOPe 2.08