SCOPe 2.08: Domain d2ffgb2: 2ffg B:2-79

Lineage for d2ffgb2 (2ffg B:2-79)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.317: YkuJ-like [143566] (1 superfamily)
   alpha-beta(4)-alpha; 2 layers a/b; antiparallel beta-sheet, order 1234

4. Superfamily d.317.1: YkuJ-like [143567] (1 family)
   automatically mapped to Pfam PF08796

5. Family d.317.1.1: YkuJ-like [143568] (1 protein)

6. Protein Hypothetical protein YkuJ [143569] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143570] (1 PDB entry)
   Uniprot O34588 2-79

8. Domain d2ffgb2: 2ffg B:2-79 [133384]
   Other proteins in same PDB: d2ffga2, d2ffgb3
   automated match to d2ffga1

Details for d2ffgb2

PDB Entry: 2ffg, 2.31 Å

PDB Description: Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.

PDB Compounds: (B:) ykuJ

SCOPe Domain Sequences for d2ffgb2:

Sequence; same for both SEQRES and ATOM records:

>d2ffgb2 d.317.1.1 (B:2-79) Hypothetical protein YkuJ {Bacillus subtilis [TaxId: 1423]}
sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt
ypfdnidmvsieifellq

Timeline for d2ffgb2:

• d2ffgb2 first appeared in SCOP 1.73, called d2ffgb1
  
• d2ffgb2 appears in SCOPe 2.07