Lineage for d2ffga1 (2ffg A:2-79)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.317: YkuJ-like [143566] (1 superfamily)
alpha-beta(4)-alpha; 2 layers a/b; antiparallel beta-sheet, order 1234Superfamily d.317.1: YkuJ-like [143567] (1 family) 
Family d.317.1.1: YkuJ-like [143568] (1 protein) Protein Hypothetical protein YkuJ [143569] (1 species) Species Bacillus subtilis [TaxId:1423] [143570] (1 PDB entry) 
Domain d2ffga1: 2ffg A:2-79 [133383]
Details for d2ffga1
PDB Entry: 2ffg (more details), 2.31 Å
PDB Description: Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.
PDB Compounds: (A:) ykuJSCOP Domain Sequences for d2ffga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffga1 d.317.1.1 (A:2-79) Hypothetical protein YkuJ {Bacillus subtilis [TaxId: 1423]}
sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt
ypfdnidmvsieifellq
SCOP Domain Coordinates for d2ffga1:
Click to download the PDB-style file with coordinates for d2ffga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ffga1:
- d2ffga1 is new in SCOP 1.73
- d2ffga1 appears in SCOP 1.75
- d2ffga1 appears in the current release, SCOPe 2.08
View in 3D
