![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.317: YkuJ-like [143566] (1 superfamily) alpha-beta(4)-alpha; 2 layers a/b; antiparallel beta-sheet, order 1234 |
![]() | Superfamily d.317.1: YkuJ-like [143567] (1 family) ![]() automatically mapped to Pfam PF08796 |
![]() | Family d.317.1.1: YkuJ-like [143568] (1 protein) |
![]() | Protein Hypothetical protein YkuJ [143569] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143570] (1 PDB entry) Uniprot O34588 2-79 |
![]() | Domain d2ffga1: 2ffg A:2-79 [133383] Other proteins in same PDB: d2ffga2, d2ffgb3 |
PDB Entry: 2ffg (more details), 2.31 Å
SCOPe Domain Sequences for d2ffga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffga1 d.317.1.1 (A:2-79) Hypothetical protein YkuJ {Bacillus subtilis [TaxId: 1423]} sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt ypfdnidmvsieifellq
Timeline for d2ffga1: