Lineage for d2ffea1 (2ffe A:1-309)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713646Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (scop_cf 52732)
  4. 713647Superfamily c.143.1: CofD-like [142338] (1 family) (S)
  5. 713648Family c.143.1.1: CofD-like [142339] (2 proteins)
    Pfam PF01933; UPF0052
  6. 713655Protein LPPG:FO 2-phospho-L-lactate transferase CofD [142340] (1 species)
  7. 713656Species Methanosarcina mazei [TaxId:2209] [142341] (1 PDB entry)
  8. 713657Domain d2ffea1: 2ffe A:1-309 [133381]

Details for d2ffea1

PDB Entry: 2ffe (more details), 2.9 Å

PDB Description: Crystal Structure of Putative 2-phospho-(S)-lactate transferase from Methanosarcina mazei, Northeast Structural Genomics Target MaR46.
PDB Compounds: (A:) LPPG:FO 2-phopspho-L-lactate transferase

SCOP Domain Sequences for d2ffea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffea1 c.143.1.1 (A:1-309) LPPG:FO 2-phospho-L-lactate transferase CofD {Methanosarcina mazei [TaxId: 2209]}
miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidr
krwwgiendtfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslf
gikanilpmsddpvstyietaegimhfqdfwigkrgepdvrgvdirgvseasispkvlea
fekeeniligpsnpitsigpiislpgmrellkkkkvvavspiignapvsgpagklmpacg
ievssmgvaeyyqdfldvfvfderdradefaferlgchasradtlmtstekskelaeivv
qaflehhhh

SCOP Domain Coordinates for d2ffea1:

Click to download the PDB-style file with coordinates for d2ffea1.
(The format of our PDB-style files is described here.)

Timeline for d2ffea1: