SCOPe 2.07: Domain d2ffdd1: 2ffd D:133-189

Lineage for d2ffdd1 (2ffd D:133-189)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen alpha chain [88887] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
   Uniprot P02671 150-209

8. Domain d2ffdd1: 2ffd D:133-189 [133380]
   automatically matched to 2FFD A:126-190
   complexed with ca, fuc, nag

Details for d2ffdd1

PDB Entry: 2ffd, 2.89 Å

PDB Description: fibrinogen fragment d with "a" knob peptide mimic gprvve

PDB Compounds: (D:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d2ffdd1:

Sequence; same for both SEQRES and ATOM records:

>d2ffdd1 h.1.8.1 (D:133-189) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvi

Timeline for d2ffdd1:

• d2ffdd1 first appeared in SCOP 1.73
  
• d2ffdd1 appears in SCOPe 2.06
  
• d2ffdd1 appears in the current release, SCOPe 2.08