Lineage for d2ffda1 (2ffd A:126-190)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752733Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 752734Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 752735Protein Fibrinogen alpha chain [88887] (4 species)
  7. 752744Species Human (Homo sapiens) [TaxId:9606] [88889] (21 PDB entries)
  8. 752765Domain d2ffda1: 2ffd A:126-190 [133379]

Details for d2ffda1

PDB Entry: 2ffd (more details), 2.89 Å

PDB Description: fibrinogen fragment d with "a" knob peptide mimic gprvve
PDB Compounds: (A:) Fibrinogen alpha/alpha-E Chain

SCOP Domain Sequences for d2ffda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffda1 h.1.8.1 (A:126-190) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqvia

SCOP Domain Coordinates for d2ffda1:

Click to download the PDB-style file with coordinates for d2ffda1.
(The format of our PDB-style files is described here.)

Timeline for d2ffda1: