Lineage for d2ffca1 (2ffc A:20-351)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079188Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2079254Species Plasmodium vivax [TaxId:5855] [141747] (1 PDB entry)
  8. 2079255Domain d2ffca1: 2ffc A:20-351 [133378]
    complexed with u5p

Details for d2ffca1

PDB Entry: 2ffc (more details), 1.7 Å

PDB Description: Crystal Structure of Plasmodium Vivax Orotidine-Monophosphate-Decarboxyl UMP Bound
PDB Compounds: (A:) orotidine 5-monophosphate decarboxylase

SCOPe Domain Sequences for d2ffca1:

Sequence, based on SEQRES records: (download)

>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]}
nlkiklqkrrdevntclcigldpdeadiksfmqsekqngyqsvkknlsnsgssssssnss
sgkgelfapqmggqmllaetppkeaqekdeffyffnhfcfyiinetkeyalaykmnfafy
lpygslgvdvlknvfdylhhlnvptildikmndigntvkhyrkfifdylrsdsctaniym
gtqmlrdicldeeckryystfvlvkttnadshifqnrlsldgkeayvviaeevqkmakql
hleengefvgfvvgancydeikkirelfpdcyilapgvgaqkgdlrkmlcngysknyekv
linvgraitksgspqqaareyhqqikevlael

Sequence, based on observed residues (ATOM records): (download)

>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]}
nlkiklqkrrdevntclcigldpdeadiksfmqsekqngyqsvkknlsnsgelfapqmgg
qmllatppkeaqekdeffyffnhfcfyiinetkeyalaykmnfafylpygslgvdvlknv
fdylhhlnvptildikmndigntvkhyrkfifdylrsdsctaniymgtqmlrdicldeec
kryystfvlvkttnadshifqnrlsldgkeayvviaeevqkmakqlhleengefvgfvvg
ancydeikkirelfpdcyilapgvgaqkgdlrkmlcngysknyekvlinvgraitksgsp
qqaareyhqqikevlael

SCOPe Domain Coordinates for d2ffca1:

Click to download the PDB-style file with coordinates for d2ffca1.
(The format of our PDB-style files is described here.)

Timeline for d2ffca1: