SCOP 1.75: Domain d2ff6a2: 2ff6 A:147-371

Lineage for d2ff6a2 (2ff6 A:147-371)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)

8. Domain d2ff6a2: 2ff6 A:147-371 [133375]
   Other proteins in same PDB: d2ff6g1
   automatically matched to d1hlua2
   complexed with atp, ca

Details for d2ff6a2

PDB Entry: 2ff6, 2.05 Å

PDB Description: crystal structure of gelsolin domain 1:ciboulot domain 2 hybrid in complex with actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d2ff6a2:

Sequence; same for both SEQRES and ATOM records:

>d2ff6a2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

Timeline for d2ff6a2:

• d2ff6a2 first appeared in SCOP 1.73
  
• d2ff6a2 appears in SCOPe 2.01
  
• d2ff6a2 appears in the current release, SCOPe 2.08