SCOPe 2.07: Domain d2ff4b2: 2ff4 B:105-283

Lineage for d2ff4b2 (2ff4 B:105-283)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.3: BTAD-like [140845] (1 protein)
   Pfam PF03704; Bacterial transcriptional activator domain

6. Protein Probable regulatory protein EmbR, middle domain [140846] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140847] (2 PDB entries)
   Uniprot P66799 105-283

8. Domain d2ff4b2: 2ff4 B:105-283 [133371]
   Other proteins in same PDB: d2ff4a1, d2ff4a3, d2ff4b1, d2ff4b3
   automatically matched to 2FEZ A:105-283

Details for d2ff4b2

PDB Entry: 2ff4, 1.9 Å

PDB Description: Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide

PDB Compounds: (B:) Probable regulatory protein embR

SCOPe Domain Sequences for d2ff4b2:

Sequence; same for both SEQRES and ATOM records:

>d2ff4b2 a.118.8.3 (B:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}
ipdntcdlgrfvaektagvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfat
alvedkvlahtakaeaeiacgrasaviaelealtfehpyreplwtqlitayylsdrqsda
lgayrrvkttladdlgidpgptlralnerilrqqpldakksakttaagtvtvldqrtma

Timeline for d2ff4b2:

• d2ff4b2 first appeared in SCOP 1.73
  
• d2ff4b2 appears in SCOPe 2.06
  
• d2ff4b2 appears in the current release, SCOPe 2.08