Lineage for d2ff4b1 (2ff4 B:10-104)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308618Family a.4.6.1: PhoB-like [46895] (6 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 2308635Protein Probable regulatory protein EmbR [140313] (1 species)
    N-terminal domain, unlike the other members
  7. 2308636Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries)
    Uniprot P66799 10-104
  8. 2308638Domain d2ff4b1: 2ff4 B:10-104 [133370]
    Other proteins in same PDB: d2ff4a2, d2ff4a3, d2ff4b2, d2ff4b3
    automatically matched to 2FEZ A:10-104

Details for d2ff4b1

PDB Entry: 2ff4 (more details), 1.9 Å

PDB Description: Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide
PDB Compounds: (B:) Probable regulatory protein embR

SCOPe Domain Sequences for d2ff4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ff4b1 a.4.6.1 (B:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]}
rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar
asihsyvsnlrkllggagidprvvlaaappgyrls

SCOPe Domain Coordinates for d2ff4b1:

Click to download the PDB-style file with coordinates for d2ff4b1.
(The format of our PDB-style files is described here.)

Timeline for d2ff4b1: