Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.1: PhoB-like [46895] (5 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
Protein Probable regulatory protein EmbR [140313] (1 species) N-terminal domain, unlike the other members |
Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries) Uniprot P66799 10-104 |
Domain d2ff4b1: 2ff4 B:10-104 [133370] Other proteins in same PDB: d2ff4a2, d2ff4a3, d2ff4b2, d2ff4b3 automatically matched to 2FEZ A:10-104 |
PDB Entry: 2ff4 (more details), 1.9 Å
SCOPe Domain Sequences for d2ff4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff4b1 a.4.6.1 (B:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]} rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar asihsyvsnlrkllggagidprvvlaaappgyrls
Timeline for d2ff4b1: