![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (10 families) ![]() |
![]() | Family a.118.8.3: BTAD-like [140845] (1 protein) Pfam PF03704; Bacterial transcriptional activator domain |
![]() | Protein Probable regulatory protein EmbR, middle domain [140846] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140847] (2 PDB entries) Uniprot P66799 105-283 |
![]() | Domain d2ff4a2: 2ff4 A:105-283 [133368] Other proteins in same PDB: d2ff4a1, d2ff4a3, d2ff4b1, d2ff4b3 automatically matched to 2FEZ A:105-283 |
PDB Entry: 2ff4 (more details), 1.9 Å
SCOPe Domain Sequences for d2ff4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} ipdntcdlgrfvaektagvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfat alvedkvlahtakaeaeiacgrasaviaelealtfehpyreplwtqlitayylsdrqsda lgayrrvkttladdlgidpgptlralnerilrqqpldakksakttaagtvtvldqrtma
Timeline for d2ff4a2: