Lineage for d2ff4a2 (2ff4 A:105-283)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339904Family a.118.8.3: BTAD-like [140845] (1 protein)
    Pfam PF03704; Bacterial transcriptional activator domain
  6. 2339905Protein Probable regulatory protein EmbR, middle domain [140846] (1 species)
  7. 2339906Species Mycobacterium tuberculosis [TaxId:1773] [140847] (2 PDB entries)
    Uniprot P66799 105-283
  8. 2339907Domain d2ff4a2: 2ff4 A:105-283 [133368]
    Other proteins in same PDB: d2ff4a1, d2ff4a3, d2ff4b1, d2ff4b3
    automatically matched to 2FEZ A:105-283

Details for d2ff4a2

PDB Entry: 2ff4 (more details), 1.9 Å

PDB Description: Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide
PDB Compounds: (A:) Probable regulatory protein embR

SCOPe Domain Sequences for d2ff4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}
ipdntcdlgrfvaektagvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfat
alvedkvlahtakaeaeiacgrasaviaelealtfehpyreplwtqlitayylsdrqsda
lgayrrvkttladdlgidpgptlralnerilrqqpldakksakttaagtvtvldqrtma

SCOPe Domain Coordinates for d2ff4a2:

Click to download the PDB-style file with coordinates for d2ff4a2.
(The format of our PDB-style files is described here.)

Timeline for d2ff4a2: