SCOPe 2.01: Domain d2ff3a1: 2ff3 A:28-152

Lineage for d2ff3a1 (2ff3 A:28-152)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (32 PDB entries)
   Uniprot P20065 55-179

8. Domain d2ff3a1: 2ff3 A:28-152 [133364]
   Other proteins in same PDB: d2ff3b1, d2ff3b2
   automatically matched to d1p8zg_
   complexed with atp, ca

Details for d2ff3a1

PDB Entry: 2ff3, 2 Å

PDB Description: Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin

PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d2ff3a1:

Sequence; same for both SEQRES and ATOM records:

>d2ff3a1 d.109.1.1 (A:28-152) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhv

Timeline for d2ff3a1:

• d2ff3a1 first appeared in SCOP 1.73
  
• d2ff3a1 appears in SCOP 1.75
  
• d2ff3a1 appears in SCOPe 2.02
  
• d2ff3a1 appears in the current release, SCOPe 2.08, called d2ff3a_